SEC63 Antibody

Name SEC63 Antibody
Supplier Novus Biologicals
Catalog NBP1-59694
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SEC63(SEC63 homolog (S. cerevisiae)) The peptide sequence was selected from the C terminal of SEC63. Peptide sequence WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene SEC63
Conjugate Unconjugated
Supplier Page Shop

Product images