TCTN3 Antibody

Name	TCTN3 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-59741
Prices	$139.00, $329.00
Sizes	20 µl, 100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB IHC
Species Reactivities	Human
Antigen	Synthetic peptides corresponding to TCTN3(tectonic family member 3) The peptide sequence was selected from the middle region of TCTN3. Peptide sequence LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS.
Purity/Format	Immunogen affinity purified
Description	Rabbit Polyclonal
Gene	TCTN3
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: TCTN3 Antibody [NBP1-59741] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Immunohistochemistry: TCTN3 Antibody [NBP1-59741] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Plasma membrane and cytoplasm in hepatocytes Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Western Blot: TCTN3 Antibody [NBP1-59741] - 721_B cell lysate, concentration 0.2-1 ug/ml.