EME1 Antibody
| Name | EME1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55350 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to EME1(essential meiotic endonuclease 1 homolog 1 (S. pombe)) The peptide sequence was selected from the middle region of EME1. Peptide sequence AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | EME1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: EME1 Antibody [NBP1-55350] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16315_EME1%2520Antibody-Western%2520Blot-NBP1-55350-img0003.jpg)
Western Blot: EME1 Antibody [NBP1-55350] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.