HP1BP3 Antibody
| Name | HP1BP3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55330 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Pig, Dog, Horse, Rabbit, Zebrafish |
| Antigen | Synthetic peptides corresponding to HP1BP3(heterochromatin protein 1, binding protein 3) The peptide sequence was selected from the middle region of HP1BP3. Peptide sequence QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HP1BP3 |
| Supplier Page | Shop |
Product images
![Western Blot: HP1BP3 Antibody [NBP1-55330] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9576_HP1BP3%2520Antibody-Western%2520Blot-NBP1-55330-img0003.jpg)
Western Blot: HP1BP3 Antibody [NBP1-55330] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.