PDLIM3 Antibody

Name PDLIM3 Antibody
Supplier Novus Biologicals
Catalog NBP1-55197
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PDLIM3(PDZ and LIM domain 3) The peptide sequence was selected from the N terminal of PDLIM3. Peptide sequence PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PDLIM3
Conjugate Unconjugated
Supplier Page Shop

Product images