NKD1 Antibody

Name NKD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55269
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NKD1(naked cuticle homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of NKD1. Peptide sequence LASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NKD1
Conjugate Unconjugated
Supplier Page Shop

Product images