POLR2K Antibody

Name POLR2K Antibody
Supplier Novus Biologicals
Catalog NBP1-55166
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to POLR2K(polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa) The peptide sequence was selected from the middle region of POLR2K (NP_005025). Peptide sequence DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene POLR2K
Conjugate Unconjugated
Supplier Page Shop

Product images