Name | POLR2K Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55166 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to POLR2K(polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa) The peptide sequence was selected from the middle region of POLR2K (NP_005025). Peptide sequence DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | POLR2K |
Conjugate | Unconjugated |
Supplier Page | Shop |