HGD Antibody

Name HGD Antibody
Supplier Novus Biologicals
Catalog NBP1-55134
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HGD(homogentisate 1,2-dioxygenase (homogentisate oxidase)) The peptide sequence was selected from the middle region of HGD. Peptide sequence KLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HGD
Conjugate Unconjugated
Supplier Page Shop

Product images