Name | UbcH5a/UBE2D1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55033 |
Prices | $299.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Pig, Dog, Goat, Zebrafish |
Antigen | Synthetic peptides corresponding to UBE2D1(ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the middle region of UBE2D1. Peptide sequence SQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE. |
Purity/Format | IgG purified |
Description | Rabbit Polyclonal |
Gene | UBE2D1 |
Supplier Page | Shop |