UbcH5a/UBE2D1 Antibody

Name UbcH5a/UBE2D1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55033
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Pig, Dog, Goat, Zebrafish
Antigen Synthetic peptides corresponding to UBE2D1(ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the middle region of UBE2D1. Peptide sequence SQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE.
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene UBE2D1
Supplier Page Shop

Product images