FBXW2 Antibody
| Name | FBXW2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55043 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FBXW2(F-box and WD repeat domain containing 2) The peptide sequence was selected from the middle region of FBXW2. Peptide sequence SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FBXW2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FBXW2 Antibody [NBP1-55043] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate FBXW2 is supported by BioGPS gene expression data to be expressed in Jurkat](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29791_FBXW2%2520Antibody-Western%2520Blot-NBP1-55043-img0007.jpg)
Western Blot: FBXW2 Antibody [NBP1-55043] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate FBXW2 is supported by BioGPS gene expression data to be expressed in Jurkat
![Western Blot: FBXW2 Antibody [NBP1-55043] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29792_FBXW2-Antibody-Western-Blot-NBP1-55043-img0003.jpg)
Western Blot: FBXW2 Antibody [NBP1-55043] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
![Western Blot: FBXW2 Antibody [NBP1-55043] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29793_FBXW2-Antibody-Western-Blot-NBP1-55043-img0004.jpg)
Western Blot: FBXW2 Antibody [NBP1-55043] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
![Western Blot: FBXW2 Antibody [NBP1-55043] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29794_FBXW2-Antibody-Western-Blot-NBP1-55043-img0005.jpg)
Western Blot: FBXW2 Antibody [NBP1-55043] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
![Western Blot: FBXW2 Antibody [NBP1-55043] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29795_FBXW2-Antibody-Western-Blot-NBP1-55043-img0006.jpg)
Western Blot: FBXW2 Antibody [NBP1-55043] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml