Carbonic Anhydrase VIII/CA8 Antibody
| Name | Carbonic Anhydrase VIII/CA8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54947 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CA8(carbonic anhydrase VIII) The peptide sequence was selected from the N terminal of CA8. Peptide sequence YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CA8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Carbonic Anhydrase VIII/CA8 Antibody [NBP1-54947] - Titration: 5.0ug/ml Positive Control: SK-MEL-2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14842_Carbonic-Anhydrase-VIII-CA8-Antibody-Western-Blot-NBP1-54947-img0003.jpg)
Western Blot: Carbonic Anhydrase VIII/CA8 Antibody [NBP1-54947] - Titration: 5.0ug/ml Positive Control: SK-MEL-2 cell lysate.