EPS8L1 Antibody
| Name | EPS8L1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56615 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to EPS8L1(EPS8-like 1) The peptide sequence was selected from the middle region of EPS8L1. Peptide sequence LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | EPS8L1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: EPS8L1 Antibody [NBP1-56615] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29835_EPS8L1-Antibody-Western-Blot-NBP1-56615-img0005.jpg)
Western Blot: EPS8L1 Antibody [NBP1-56615] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
![Western Blot: EPS8L1 Antibody [NBP1-56615] - Hela cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29836_EPS8L1-Antibody-Western-Blot-NBP1-56615-img0002.jpg)
Western Blot: EPS8L1 Antibody [NBP1-56615] - Hela cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: EPS8L1 Antibody [NBP1-56615] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29837_EPS8L1-Antibody-Western-Blot-NBP1-56615-img0004.jpg)
Western Blot: EPS8L1 Antibody [NBP1-56615] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
![Western Blot: EPS8L1 Antibody [NBP1-56615] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29838_EPS8L1-Antibody-Western-Blot-NBP1-56615-img0003.jpg)
Western Blot: EPS8L1 Antibody [NBP1-56615] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.
![Western Blot: EPS8L1 Antibody [NBP1-56615] - Jurkat, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that EPS8L1 is expressed in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29839_EPS8L1%2520Antibody-Western%2520Blot-NBP1-56615-img0006.jpg)
Western Blot: EPS8L1 Antibody [NBP1-56615] - Jurkat, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that EPS8L1 is expressed in Jurkat.