ACBD7 Antibody
| Name | ACBD7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56527 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ACBD7(acyl-Coenzyme A binding domain containing 7) The peptide sequence was selected from the N terminal of ACBD7 (NP_001034933). Peptide sequence MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ACBD7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ACBD7 Antibody [NBP1-56527] - Human Brain lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10243_ACBD7%2520Antibody-Western%2520Blot-NBP1-56527-img0002.jpg)
Western Blot: ACBD7 Antibody [NBP1-56527] - Human Brain lysate, concentration 0.2-1 ug/ml.
![Immunocytochemistry/Immunofluorescence: ACBD7 Antibody [NBP1-56527] - Analysis of ACBD7 in 3T3-L1 cells using ACBD7 antibody. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10244_ACBD7-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-56527-img0004.jpg)
Immunocytochemistry/Immunofluorescence: ACBD7 Antibody [NBP1-56527] - Analysis of ACBD7 in 3T3-L1 cells using ACBD7 antibody. Image from verified customer review.
![Immunohistochemistry-Paraffin: ACBD7 Antibody [NBP1-56527] - Mouse arcuate nucleus stained with ACBD7 (brown) and GFAP (black) antibodies. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10245_ACBD7-Antibody-Immunohistochemistry-Paraffin-NBP1-56527-img0003.jpg)
Immunohistochemistry-Paraffin: ACBD7 Antibody [NBP1-56527] - Mouse arcuate nucleus stained with ACBD7 (brown) and GFAP (black) antibodies. Image from verified customer review.
![Immunofluorescence: ACBD7 Antibody [NBP1-56527] - Mouse arcuate nucleus stained with ACBD7 antibody. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10246_ACBD7-Antibody-Immunofluorescence-NBP1-56527-img0005.jpg)
Immunofluorescence: ACBD7 Antibody [NBP1-56527] - Mouse arcuate nucleus stained with ACBD7 antibody. Image from verified customer review.