Kallikrein 13 Antibody

Name Kallikrein 13 Antibody
Supplier Novus Biologicals
Catalog NBP1-56348
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KLK13(kallikrein-related peptidase 13) The peptide sequence was selected from the middle region of KLK13. Peptide sequence VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KLK13
Conjugate Unconjugated
Supplier Page Shop

Product images