UNC50 Antibody

Name UNC50 Antibody
Supplier Novus Biologicals
Catalog NBP1-59665
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Zebrafish
Antigen Synthetic peptides corresponding to UNC50(unc-50 homolog (C. elegans)) The peptide sequence was selected from the N terminal of UNC50. Peptide sequence LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene UNC50
Supplier Page Shop

Product images