SPATA9 Antibody

Name SPATA9 Antibody
Supplier Novus Biologicals
Catalog NBP1-59460
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SPATA9(spermatogenesis associated 9) The peptide sequence was selected from the N terminal of SPATA9. Peptide sequence PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SPATA9
Conjugate Unconjugated
Supplier Page Shop

Product images