PLEKHA7 Antibody

Name PLEKHA7 Antibody
Supplier Novus Biologicals
Catalog NBP1-79526
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human PLEKHA7The immunogen for this antibody is PLEKHA7 (NP_778228). Peptide sequence PESRYQTLPGRGLSGSTSRLQQSSTIAPYVTLRRGLNAESSKATFPRPKS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PLEKHA7
Conjugate Unconjugated
Supplier Page Shop

Product images