ECHDC2 Antibody

Name ECHDC2 Antibody
Supplier Novus Biologicals
Catalog NBP1-79297
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human ECHDC2The immunogen for this antibody is ECHDC2. Peptide sequence FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ECHDC2
Conjugate Unconjugated
Supplier Page Shop

Product images