SPATA6 Antibody
| Name | SPATA6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70710 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SPATA6(spermatogenesis associated 6) The peptide sequence was selected from the middle region of SPATA6. Peptide sequence SQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SPATA6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SPATA6 Antibody [NBP1-70710] - Sample Tissue: Human HCT116 Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7146_SPATA6-Antibody-Western-Blot-NBP1-70710-img0003.jpg)
![Western Blot: SPATA6 Antibody [NBP1-70710] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7147_SPATA6-Antibody-Western-Blot-NBP1-70710-img0002.jpg)