LEMD2 Antibody

Name LEMD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-70599
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LEMD2(LEM domain containing 2) The peptide sequence was selected from the middle region of LEMD2. Peptide sequence SRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LEMD2
Conjugate Unconjugated
Supplier Page Shop

Product images