PPP1R11 Antibody

Name PPP1R11 Antibody
Supplier Novus Biologicals
Catalog NBP1-70681
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PPP1R11(protein phosphatase 1, regulatory (inhibitor) subunit 11) The peptide sequence was selected from the N terminal of PPP1R11. Peptide sequence MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PPP1R11
Conjugate Unconjugated
Supplier Page Shop

Product images