| Name | Semaphorin 6A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69281 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SEMA6A(sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A) The peptide sequence was selected from the middle region of SEMA6A. Peptide sequence ERVPKPRPGCCAGSSSLERYATSNEFPDDT |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SEMA6A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |