Name | ABCB10 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69066 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Antigen | Synthetic peptides corresponding to Abcb10 (ATP-binding cassette, sub-family B (MDR/TAP), member 10) The peptide sequence was selected from the N terminal of Abcb10. Peptide sequence NGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSD. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | Abcb10 |
Conjugate | Unconjugated |
Supplier Page | Shop |