ABCB10 Antibody

Name ABCB10 Antibody
Supplier Novus Biologicals
Catalog NBP1-69066
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptides corresponding to Abcb10 (ATP-binding cassette, sub-family B (MDR/TAP), member 10) The peptide sequence was selected from the N terminal of Abcb10. Peptide sequence NGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Abcb10
Conjugate Unconjugated
Supplier Page Shop

Product images