PLA2G4B Antibody

Name PLA2G4B Antibody
Supplier Novus Biologicals
Catalog NBP1-80305
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human PLA2G4B. Peptide sequence: AEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRP
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene JMJD7-PLA2G4B
Conjugate Unconjugated
Supplier Page Shop

Product images