KLHL4 Antibody

Name KLHL4 Antibody
Supplier Novus Biologicals
Catalog NBP1-80343
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Horse, Rabbit
Antigen Synthetic peptide directed towards the N terminal of human KLHL4. Peptide sequence CLQQEGYEHRGTPVQGRLKSHSRDRNGLKKSNSPVHHNILAPVPGPAPAH.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene KLHL4
Supplier Page Shop

Product images