| Name | GABA-A R rho 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80060 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human GABRR1. Peptide sequence EMSKKGRPQRQRREVHEDAHKQVSPILRRSPDITKSPLTKSEQLLRIDDH. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GABRR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |