BMP2K Antibody

Name BMP2K Antibody
Supplier Novus Biologicals
Catalog NBP1-52902
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to BMP2K(BMP2 inducible kinase) The peptide sequence was selected from the middle region of BMP2K. Peptide sequence VKVLAPGEFGNHRPKGALRPGNGPEILLGQGPPQQPPQQHRVLQQLQQGD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene BMP2K
Conjugate Unconjugated
Supplier Page Shop

Product images