MSH4 Antibody

Name MSH4 Antibody
Supplier Novus Biologicals
Catalog NBP1-58198
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MSH4(mutS homolog 4 (E. coli)) The peptide sequence was selected from the middle region of MSH4. Peptide sequence EITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MSH4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.