DNA polymerase mu Antibody

Name DNA polymerase mu Antibody
Supplier Novus Biologicals
Catalog NBP1-58202
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to POLM(polymerase (DNA directed), mu) The peptide sequence was selected from the middle region of POLM (NP_037416). Peptide sequence LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene POLM
Conjugate Unconjugated
Supplier Page Shop

Product images