CENPB Antibody

Name CENPB Antibody
Supplier Novus Biologicals
Catalog NBP1-58103
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CENPB(centromere protein B, 80kDa) The peptide sequence was selected from the C terminal of CENPB. Peptide sequence GGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CENPB
Conjugate Unconjugated
Supplier Page Shop

Product images