ST3GAL4 Antibody
| Name | ST3GAL4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62481 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ST3GAL4(ST3 beta-galactoside alpha-2,3-sialyltransferase 4) The peptide sequence was selected from the middle region of ST3GAL4. Peptide sequence IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ST3GAL4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ST3GAL4 Antibody [NBP1-62481] - Sample Type: MCF7 Antibody Dilution: 1.0 ug/ml ST3GAL4 is supported by BioGPS gene expression data to be expressed in MCF7](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24100_ST3GAL4-Antibody-Western-Blot-NBP1-62481-img0004.jpg)
Western Blot: ST3GAL4 Antibody [NBP1-62481] - Sample Type: MCF7 Antibody Dilution: 1.0 ug/ml ST3GAL4 is supported by BioGPS gene expression data to be expressed in MCF7
![Western Blot: ST3GAL4 Antibody [NBP1-62481] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24101_ST3GAL4-Antibody-Western-Blot-NBP1-62481-img0002.jpg)
Western Blot: ST3GAL4 Antibody [NBP1-62481] - 721_B cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: ST3GAL4 Antibody [NBP1-62481] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml ST3GAL4 is supported by BioGPS gene expression data to be expressed in HeLa](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24102_ST3GAL4-Antibody-Western-Blot-NBP1-62481-img0003.jpg)
Western Blot: ST3GAL4 Antibody [NBP1-62481] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml ST3GAL4 is supported by BioGPS gene expression data to be expressed in HeLa