Wnt-6 Antibody

Name Wnt-6 Antibody
Supplier Novus Biologicals
Catalog NBP1-62305
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to WNT6(wingless-type MMTV integration site family, member 6) The peptide sequence was selected from the middle region of WNT6. Peptide sequence ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene WNT6
Supplier Page Shop

Product images