UGT8 Antibody

Name UGT8 Antibody
Supplier Novus Biologicals
Catalog NBP1-62245
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to UGT8(UDP glycosyltransferase 8) The peptide sequence was selected from the middle region of UGT8. Peptide sequence GILLEWKTVTEKELYEALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene UGT8
Conjugate Unconjugated
Supplier Page Shop

Product images