HepaCAM Antibody

Name HepaCAM Antibody
Supplier Novus Biologicals
Catalog NBP1-60020
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HEPACAM(hepatocyte cell adhesion molecule) The peptide sequence was selected from the N terminal of HEPACAM. Peptide sequence LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HEPACAM
Conjugate Unconjugated
Supplier Page Shop

Product images