| Name | beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59863 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to B4GALT2(UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2) The peptide sequence was selected from the middle region of B4GALT2. Peptide sequence RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVI |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | B4GALT2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |