FATP3/SLC27A3 Antibody
| Name | FATP3/SLC27A3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59839 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC27A3 (solute carrier family 27 (fatty acid transporter), member 3) The peptide sequence was selected from the middle region of SLC27A3)(50ug). Peptide sequence PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQS |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC27A3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: FATP3/SLC27A3 Antibody [NBP1-59839] - PANC1 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6903_FATP3-SLC27A3-Antibody-Western-Blot-NBP1-59839-img0002.jpg)
![Western Blot: FATP3/SLC27A3 Antibody [NBP1-59839] - Antibody Titration: 1 ug/ml Human MCF7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6904_FATP3-SLC27A3%2520Antibody-Western%2520Blot-NBP1-59839-img0003.jpg)