TIN-Ag Antibody

Name TIN-Ag Antibody
Supplier Novus Biologicals
Catalog NBP1-56968
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TINAG (tubulointerstitial nephritis antigen) The peptide sequence was selected from the middle region of TINAG. Peptide sequence VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TINAG
Conjugate Unconjugated
Supplier Page Shop

Product images