IPP Antibody

Name IPP Antibody
Supplier Novus Biologicals
Catalog NBP1-56903
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to IPP(intracisternal A particle-promoted polypeptide) The peptide sequence was selected from the C terminal of IPP (NP_005888). Peptide sequence EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene IPP
Conjugate Unconjugated
Supplier Page Shop

Product images