DIP2A Antibody

Name DIP2A Antibody
Supplier Novus Biologicals
Catalog NBP1-56909
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DIP2A(DIP2 disco-interacting protein 2 homolog A (Drosophila)) The peptide sequence was selected from the N terminal of DIP2A. Peptide sequence PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DIP2A
Conjugate Unconjugated
Supplier Page Shop

Product images