SMG5 Antibody

Name SMG5 Antibody
Supplier Novus Biologicals
Catalog NBP1-56778
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SMG5(Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans)) The peptide sequence was selected from the N terminal of SMG5. Peptide sequence MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SMG5
Conjugate Unconjugated
Supplier Page Shop

Product images