LSM14A Antibody
| Name | LSM14A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56784 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LSM14A(LSM14A, SCD6 homolog A (S. cerevisiae)) The peptide sequence was selected from the middle region of LSM14A. Peptide sequence KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LSM14A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LSM14A Antibody [NBP1-56784] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19884_LSM14A-Antibody-Western-Blot-NBP1-56784-img0005.jpg)
Western Blot: LSM14A Antibody [NBP1-56784] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
![Immunohistochemistry: LSM14A Antibody [NBP1-56784] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm and plasma membrane in hepatocytes and sinusoids Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19885_LSM14A-Antibody-Immunohistochemistry-NBP1-56784-img0004.jpg)
Immunohistochemistry: LSM14A Antibody [NBP1-56784] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm and plasma membrane in hepatocytes and sinusoids Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
![Western Blot: LSM14A Antibody [NBP1-56784] - 721_B Cell Lysate 1.0ug/ml, Gel Concentration 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19886_LSM14A-Antibody-Western-Blot-NBP1-56784-img0001.jpg)
Western Blot: LSM14A Antibody [NBP1-56784] - 721_B Cell Lysate 1.0ug/ml, Gel Concentration 12%
![Western Blot: LSM14A Antibody [NBP1-56784] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19887_LSM14A-Antibody-Western-Blot-NBP1-56784-img0002.jpg)
Western Blot: LSM14A Antibody [NBP1-56784] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
![Western Blot: LSM14A Antibody [NBP1-56784] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Hela cell lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19888_LSM14A%2520Antibody-Western%2520Blot-NBP1-56784-img0006.jpg)
Western Blot: LSM14A Antibody [NBP1-56784] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Hela cell lysate