SYDE1 Antibody
| Name | SYDE1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57607 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SYDE1(synapse defective 1, Rho GTPase, homolog 1 (C. elegans)) The peptide sequence was selected from the C terminal of SYDE1. Peptide sequence PYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGRDFL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SYDE1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SYDE1 Antibody [NBP1-57607] - Lanes: 1: 2ug mouse SYDE1 transfected HEK293T lysate, 2: 15ug untransfected HEK293T lysate, 3: 100ug wild type mouse brain lysate, 4: 100ug SYDE1 knock-out mouse brain lysate Primary Antibody Dilution: 1:500 Secondary Antibody: Anti-rabbit L-chain HRP Sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24145_SYDE1-Antibody-Western-Blot-NBP1-57607-img0006.jpg)
Western Blot: SYDE1 Antibody [NBP1-57607] - Lanes: 1: 2ug mouse SYDE1 transfected HEK293T lysate, 2: 15ug untransfected HEK293T lysate, 3: 100ug wild type mouse brain lysate, 4: 100ug SYDE1 knock-out mouse brain lysate Primary Antibody Dilution: 1:500 Secondary Antibody: Anti-rabbit L-chain HRP Sec
![Western Blot: SYDE1 Antibody [NBP1-57607] - Hela, Antibody Dilution: 1.0 ug/ml SYDE1 is supported by BioGPS gene expression data to be expressed in HeLa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24146_SYDE1-Antibody-Western-Blot-NBP1-57607-img0003.jpg)
Western Blot: SYDE1 Antibody [NBP1-57607] - Hela, Antibody Dilution: 1.0 ug/ml SYDE1 is supported by BioGPS gene expression data to be expressed in HeLa.
![Western Blot: SYDE1 Antibody [NBP1-57607] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24147_SYDE1-Antibody-Western-Blot-NBP1-57607-img0004.jpg)
Western Blot: SYDE1 Antibody [NBP1-57607] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.