SRP19 Antibody

Name	SRP19 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-57415
Prices	$139.00, $329.00
Sizes	20 µl, 100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB IHC
Species Reactivities	Human
Antigen	Synthetic peptides corresponding to SRP19(signal recognition particle 19kDa) The peptide sequence was selected from the middle region of SRP19. Peptide sequence CLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKK.
Purity/Format	Immunogen affinity purified
Description	Rabbit Polyclonal
Gene	SRP19
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: SRP19 Antibody [NBP1-57415] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:12500 Positive Control: Human Small Intestine

Immunohistochemistry: SRP19 Antibody [NBP1-57415] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Immunohistochemistry: SRP19 Antibody [NBP1-57415] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.