CUGBP2 Antibody
| Name | CUGBP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57376 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CUGBP2 (CUG triplet repeat, RNA binding protein 2) The peptide sequence was selected from the N terminal of CUGBP2. Peptide sequence VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CELF2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CUGBP2 Antibody [NBP1-57376] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29858_CUGBP2-Antibody-Western-Blot-NBP1-57376-img0007.jpg)
Western Blot: CUGBP2 Antibody [NBP1-57376] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
![Immunohistochemistry: CUGBP2 Antibody [NBP1-57376] - Paraffin Embedded Tissue: Human Heart Cellular Data: Myocardial cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29859_CUGBP2-Antibody-Immunohistochemistry-NBP1-57376-img0006.jpg)
Immunohistochemistry: CUGBP2 Antibody [NBP1-57376] - Paraffin Embedded Tissue: Human Heart Cellular Data: Myocardial cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
![Western Blot: CUGBP2 Antibody [NBP1-57376] - Reccomended Titration: 1.25 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate CELF2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29860_CUGBP2%2520Antibody-Western%2520Blot-NBP1-57376-img0008.jpg)
Western Blot: CUGBP2 Antibody [NBP1-57376] - Reccomended Titration: 1.25 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate CELF2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
![Immunohistochemistry: CUGBP2 Antibody [NBP1-57376] - Paraffin Embedded Tissue: Human alveolar cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29861_CUGBP2-Antibody-Immunohistochemistry-NBP1-57376-img0005.jpg)
Immunohistochemistry: CUGBP2 Antibody [NBP1-57376] - Paraffin Embedded Tissue: Human alveolar cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X