RBM42 Antibody

Name RBM42 Antibody
Supplier Novus Biologicals
Catalog NBP1-57523
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RBM42 (RNA binding motif protein 42) The peptide sequence was selected from the middle region of RBM42)(50ug). Peptide sequence RPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RBM42
Conjugate Unconjugated
Supplier Page Shop

Product images