RG9MTD1 Antibody

Name RG9MTD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57361
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Horse, Guinea Pig, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to RG9MTD1 (RNA (guanine-9-) methyltransferase domain containing 1) The peptide sequence was selected from the middle region of RG9MTD1. Peptide sequence MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene TRMT10C
Supplier Page Shop

Product images