Name | RG9MTD1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57361 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Pig, Horse, Guinea Pig, Rabbit, Zebrafish |
Antigen | Synthetic peptides corresponding to RG9MTD1 (RNA (guanine-9-) methyltransferase domain containing 1) The peptide sequence was selected from the middle region of RG9MTD1. Peptide sequence MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | TRMT10C |
Supplier Page | Shop |