CIN85/SH3KBP1 Antibody

Name CIN85/SH3KBP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57065
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to SH3KBP1 (SH3-domain kinase binding protein 1) The peptide sequence was selected from the N terminal of SH3KBP1. Peptide sequence TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SH3KBP1
Supplier Page Shop

Product images