Nidogen-2 Antibody

Name Nidogen-2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59148
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NID2(nidogen 2 (osteonidogen)) The peptide sequence was selected from the middle region of NID2. Peptide sequence DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NID2
Conjugate Unconjugated
Supplier Page Shop

Product images