Name | ADAM33 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59046 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ADAM33(ADAM metallopeptidase domain 33) The peptide sequence was selected from the middle region of ADAM33 (NP_079496). Peptide sequence HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ADAM33 |
Conjugate | Unconjugated |
Supplier Page | Shop |