ADAM33 Antibody

Name ADAM33 Antibody
Supplier Novus Biologicals
Catalog NBP1-59046
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ADAM33(ADAM metallopeptidase domain 33) The peptide sequence was selected from the middle region of ADAM33 (NP_079496). Peptide sequence HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ADAM33
Conjugate Unconjugated
Supplier Page Shop

Product images