RASGEF1C Antibody

Name RASGEF1C Antibody
Supplier Novus Biologicals
Catalog NBP1-58874
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RASGEF1C(RasGEF domain family, member 1C) The peptide sequence was selected from the middle region of RASGEF1C. Peptide sequence FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RASGEF1C
Conjugate Unconjugated
Supplier Page Shop

Product images